SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.grail3.0061003301 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.grail3.0061003301
Domain Number 1 Region: 25-138
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000162
Family Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.grail3.0061003301
Sequence length 150
Comment (Populus trichocarpa)
Sequence
MVVFYSKQEELRTPQESQHGDAVMEATVRVRNGSVLGKGSILKMYFFPGQRTSSHIQIQG
APHVYKMLQVDGYPVYSMATPTITGAKEMLAYLSAKPKIEGSLTRKVILTDLREEAVVYI
NGTPYVLRELNKPVDVLKHVGITGPVVRHC
Download sequence
Identical sequences 3694.grail3.0061003301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]