SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.grail3.0070002601 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.grail3.0070002601
Domain Number 1 Region: 127-183
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000886
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.grail3.0070002601
Sequence length 218
Comment (Populus trichocarpa)
Sequence
MAEVDQGFGEHEIDHGVDLSADQGVGHPVDHDLDNAADHGLDHAVDHSLGHSVDHGLDHA
TDPGLAVEHDIDHPIDHHVDPSIDHDVDHPVNHDIDHAIDQVPENFEASKQGQDEDTVSG
GGSEKRWPGWPGESVFRMLVPAQKVGSIIGRKGEFIKKIVEETRARIKILDGPPGTTERA
VSFSFPPSLICATSLSGKCRTRMVGRICRCKVFDGDLP
Download sequence
Identical sequences 3694.grail3.0070002601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]