SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.grail3.0078003301 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.grail3.0078003301
Domain Number 1 Region: 151-277
Classification Level Classification E-value
Superfamily TRAF domain-like 2.78e-33
Family MATH domain 0.0043
Further Details:      
 
Domain Number 2 Region: 1-137
Classification Level Classification E-value
Superfamily TRAF domain-like 7.03e-33
Family MATH domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.grail3.0078003301
Sequence length 291
Comment (Populus trichocarpa)
Sequence
MKIDSFSLLSDMVANSYLEQYESREFDASGYKWKLVLYPNGDKSRNGDGYISLYLVIADT
TGFPAGWEINAIFKLFVYDQLQDKYLTIGDGRLRRFCAIMNKWGFPQMLPLSTFNNASNG
YLIGDSCVFGAEVFVVKSEGKGEHFSMIKDPSDGTFTWEVQYFSGLTGEFYYSQVYLAGG
HEWKLKLFPKGHIKQRGKYLSLFLELDDCTKSHTGWKLFVEFTLRIKDQVQSHHHEKTIH
KWFSASENNWGLVSFISLSDIKNPSNNFIVNDTLIVEGVLNRLSVLKEFAG
Download sequence
Identical sequences 3694.grail3.0078003301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]