SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.gw1.184.69.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.gw1.184.69.1
Domain Number 1 Region: 6-140
Classification Level Classification E-value
Superfamily STI-like 7.66e-48
Family Kunitz (STI) inhibitors 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.gw1.184.69.1
Sequence length 141
Comment (Populus trichocarpa)
Sequence
VAATAAPEPVLDVTGKILRTGTSYYILPVIRGRGGGLKMASTVRRTCPLDVVQDRYEASN
GLPLKFTPVNTKKGVVRVHTDLNIRFSAGSICHQSTAWKLDNYDEWTKQWFVTTDGVEGN
PGPETTNNWFKIEKFEDKYKL
Download sequence
Identical sequences 3694.gw1.184.69.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]