SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.gw1.I.2477.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.gw1.I.2477.1
Domain Number 1 Region: 332-536
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-47
Family Ribonuclease PH domain 1-like 0.0000366
Further Details:      
 
Domain Number 2 Region: 42-183
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-41
Family Ribonuclease PH domain 1-like 0.0000409
Further Details:      
 
Domain Number 3 Region: 491-594
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.09e-23
Family Ribonuclease PH domain 2-like 0.00022
Further Details:      
 
Domain Number 4 Region: 265-367
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.62e-21
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.003
Further Details:      
 
Domain Number 5 Region: 177-270
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.13e-20
Family Ribonuclease PH domain 2-like 0.0019
Further Details:      
 
Domain Number 6 Region: 653-741
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.8e-17
Family Cold shock DNA-binding domain-like 0.00097
Further Details:      
 
Domain Number 7 Region: 589-663
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000091
Family Eukaryotic type KH-domain (KH-domain type I) 0.007
Further Details:      
 
Weak hits

Sequence:  3694.gw1.I.2477.1
Domain Number - Region: 875-939
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000298
Family Cold shock DNA-binding domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.gw1.I.2477.1
Sequence length 950
Comment (Populus trichocarpa)
Sequence
SLPRFLTWRSLGFRTICSGRLGFAPSDPDPEPPVSTAGTKFLETFREEFEIGSRLITFET
GKIARFANGSVVLGMEETKVLSTVTSSKGDSVRDFLPLTVDYQEKQFAQGVIPSTYLRRE
GAPKERELLCGRLIDRPIRPLFPAGFYHEVQVMASVLSSDGRRDPDVMAANATSAALMLS
DIPWGGPIGVIRIGRICGQFVVNPTMDELSLSDLNLVYACTKDKTLMIDVQAGGIAEKDL
EAGLRLAHPEAVKYLEPQIRLAAKAGKHKKDYKLSLVSDRTLEKVRNLTEAKIEAVFTDP
SYGKFERGEALDNIAQEAKRTLEEECDTESLTVLSKVVDRVRKGVVRNRIIAEGFRVDGR
RLDEVRPLYCEAGYLPNLHGSSLFSRGDTQVLCTVTLGAPRDAQRLDSLVGPPTKRFMLH
YSFPPFSINEVGKRVGLNRREVGHGTLAEKALLAVLPPEDDFPYTVRINSEVMASDGSTS
MATVCGGSVAMMDAGIPLQEHVAGVSVGLVSEVDPSTGEIKDYRIVTDILGLEDHLGDMD
FKIAGTRKGVTAVQLDIKPAGIPLDIICECLEPALKGRLQILARMDQEISAPRTQDHRNS
PRLATLKFSNDALRRLIGPLGVLKRKIEEDTGARMSVSDETLTILAKNQTVLERVQEKID
FIIGREIEVGGIYKGIVSSIKEYGAFVEFNGGQQGLLHVSELSHEPVSKISDVISVGQQL
SLMCIGQDVRGNIKLSLKATLPQLKSKKNNVTEEPVPVIKEAPKVWTSVGNLPNEQEEQK
LTDAELMLSRSTVKPSTSSNPGFLIRSAAECDEEDKTVSLNQGSKSNSKTLRATKRDRKR
KTKVPESDDSDASIYSSGHSSHTVDRLNDEDAKVVSPLSAKSLKLGMKIAAKVYQIRALG
LVLDLGNGVRGMYRFETNGKRDFEIGDELLVKCTSFSSKGLPVMSLVDDE
Download sequence
Identical sequences 3694.gw1.I.2477.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]