SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.gw1.I.6146.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.gw1.I.6146.1
Domain Number 1 Region: 372-727
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-119
Family Motor proteins 0.000000872
Further Details:      
 
Domain Number 2 Region: 10-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-21
Family Calponin-homology domain, CH-domain 0.0018
Further Details:      
 
Weak hits

Sequence:  3694.gw1.I.6146.1
Domain Number - Region: 257-369
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000115
Family BAR domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.gw1.I.6146.1
Sequence length 969
Comment (Populus trichocarpa)
Sequence
MDKGGSRSLPKEPSEEEFCLALRNGLILCNVLNKVNPGAVLKARASSNPTSVLSTEGAAQ
SAIQYFENMRNFLVAVKDMKLLTFEASDLEKGGSSSKVVDCILCLKGYYEWKQAGGIGVW
RYGGLVKIVSFPKELPSSLVGSESADESVDESESSQYEQLLEFLHLSNEVAIEETKTANA
LAFLFDHFGLRLLQAYLKESNGIEELPLNGMVVDALLSKVVKDFSALLVSQGTQLGLLLK
KILKGDIGSLSKTEFIEAISQYLRQRTSLASSDFSKFCVCGGKKETIRHIVSNSSGHAEV
IDLHQKQLEELRFHYKETRQQVKQIQAGWEEEVGRLEHHITDLEVASSTYHQVLEENRQL
YNQVQDLKAGTIRVYCRVRPFLPGQSSRQSAVDYIGENGNIMIVNPLKNGKEARKVFSFN
KVFGSNVTQEQIYVDTQPLVRSVLDGYNVCIFAYGQTGSGKTYTMSGPDLTSEETWGVNY
RALRDLFQISKTRGDVIKYEVGVQMIEIYNEQVRDLLVNIRNNSQLNGLNVPDASWIPVS
STQDVLDLMKIGHRNRAVGATALNERSSRSHSVLTVHVYGKELVSGSILKGCLHLVDLAG
SERVDKSEAVGERLKEAQHINRSLSALGDVISALAQKSPHVPYRNSKLTQVLQDSLGGHA
KTLMFVHINPELNSTGETISTLKFAERVASIELGAAKSNKETGEIRELKEEISNLKQALE
RKEAEMEQIKGGSTRSTTESQRTRAVSPFSVPRYGTNANFKPETSQRSNDDTKRSEIRSC
SSGKQRRSRFPSSLTDKEILPRIPFLGEEMLASSTKPRSPSPPVRRSISTDRGAHIRSRV
KETVENQPVARVPFPARVPINKSIAAIPVIPSADNSSKGPYKGSQEAVKQDNISNAFYNF
QRVSTRKVYPEHDEEQFRQALNIRQGGIRKVKNESKVKAKHQLPAKFNKSDVGTTMLSDI
DAEPRKSDF
Download sequence
Identical sequences 3694.gw1.I.6146.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]