SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.gw1.I.8953.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.gw1.I.8953.1
Domain Number 1 Region: 421-782
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-117
Family Motor proteins 0.000000975
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000772
Family Calponin-homology domain, CH-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.gw1.I.8953.1
Sequence length 931
Comment (Populus trichocarpa)
Sequence
QSLVEWLNHALPHLNMPLDASEEELRAYLIDGTVLCSILNKFCPGLVEMRGSSEPGPENI
RKFLAAMDELALPRFVLADIQECLVTLKTHIEFNGGKESIREHLRRRWNLPKMEFSEGID
NSQMFQQKQGSYADLSDSNILELMKSNGLDNTSTRTLFSLVNRILEESIERKNGHVHHQM
AHIVKKVVQVIEQRVSTLAVNLKDQNNLYKVRLGKCQSRIKVLETLAAGTTEEIRVLLSQ
LQQIKIEKTKIEEKKKLEEQELLRTKQEKIHSDIENSTLKHELEIAKTTHEEHCLLLQVQ
AEETKVELEKKLKELECFLAESMKRVKELESFSESKSQRWKSKEGSYRSFIDYQSRALKE
LRAAADSVKHEILKAKRSYAEEFNFLAGVKLKGLADAAANYHSVLAENRRLYNEVQDLKG
NIRVYCRIRPFLPGQSKKRTTVEYIGENGELVISNPSKQGKDSHRLFKLNKVFGPAATQE
EVFLDTQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNMTSQEDWGVNYRALHDLFQIS
QNRKSSISYEVGVQMVEIYNEQVRDLLSTLTGLILTTQPNGLAVPDASMHAVTSTADVLE
LMRIGLMNRAVGATALNERSSRSHSVLTIHVYGMDLETGAVLRGNLHLVDLAGSERVDRS
EATGERLREAQHINKSLSALGDVIFSLAQKSQHVPYRNSKLTQVLQSSLGGQAKTLMFVQ
LNPDVDSYSETISTLKFAERVSGVELGAAKSNKEGRNIRELMEQVGLLKETISRKDEEIE
RLQHLQASGNSVKCDMNSRRYDSSSPRRHSIGTALHNHRLSGGKGSGLFEKASSDTDNCS
GNSERHSEAGSSKSMDYLSLKKEFVSQPKFVGPGVDQNDKEDLDLLGFGDADSDERLSDI
SDGCLSRAETEGSLGSAVEFTLFPESKPSEV
Download sequence
Identical sequences 3694.gw1.I.8953.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]