SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.gw1.III.1342.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.gw1.III.1342.1
Domain Number 1 Region: 175-349
Classification Level Classification E-value
Superfamily LigT-like 0.000000249
Family 2'-5' RNA ligase LigT 0.061
Further Details:      
 
Domain Number 2 Region: 1-65
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000584
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.gw1.III.1342.1
Sequence length 351
Comment (Populus trichocarpa)
Sequence
VDASLIQFIKGKVGSAQKRIEEEMAVKIVFPSSKNEESIVIEGISTDCVTRVSVKIQAII
DEAIKTDLDYSHFVSLPLGIYPELVDKLVDFQNSILGINYVSVDANVESDYNEDTSDIKN
KGQELIEGDDEAVELKAEDDNHVKVDLTSIPFVSYPPKPRRLPNASDFGIDKTIFIKPTT
FHLTVLMLKLWNKERVNAASDVLKSISSKVIDALDNRPVSIRLKGLVSRIGLSRARVLYA
PVEEIGSEDRLLRACPFLEVIIDAFVEAGLVLEKDAKHKLKLHATVMNARNRKGKRQSKN
DSFDARGIFKQFGSEDWGEYVIPEAHLSQRFVYDENGYYHCCASIPFPGKE
Download sequence
Identical sequences 3694.gw1.III.1342.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]