SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.gw1.VI.615.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.gw1.VI.615.1
Domain Number 1 Region: 109-177
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000108
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 2 Region: 199-230
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000903
Family CCCH zinc finger 0.0015
Further Details:      
 
Domain Number 3 Region: 35-61
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000406
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.gw1.VI.615.1
Sequence length 232
Comment (Populus trichocarpa)
Sequence
MDTRKRGRPDFKTNGFGGFKKSKQEMDPLSTGVGSKLKPCTKFFSTAGCPFGESCHFLHH
VPGGYNAVTQMMNLGPTVTPPSRSVPGHLGGRVEQPSPGPATSFGVFATTTRISVNASLA
GFIIGKGGVHSIQICHQTGVKLSIKEHETNPNLKNIELEGSFEQIAQASKMVEELVKVNS
AKAAAKTSGGRGGHANPGSNYKTKLCDNFAKGSCTFGQRCHFAHGAAELRKT
Download sequence
Identical sequences 3694.gw1.VI.615.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]