SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.gw1.XIX.1195.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.gw1.XIX.1195.1
Domain Number 1 Region: 362-534
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.29e-45
Family Ribonuclease PH domain 1-like 0.0000358
Further Details:      
 
Domain Number 2 Region: 23-160
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.45e-40
Family Ribonuclease PH domain 1-like 0.0000603
Further Details:      
 
Domain Number 3 Region: 516-618
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.21e-23
Family Ribonuclease PH domain 2-like 0.0002
Further Details:      
 
Domain Number 4 Region: 164-246
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.17e-22
Family Ribonuclease PH domain 2-like 0.0019
Further Details:      
 
Domain Number 5 Region: 620-689
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000921
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 
Domain Number 6 Region: 255-304
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000981
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.gw1.XIX.1195.1
Sequence length 730
Comment (Populus trichocarpa)
Sequence
VNAFEETSVAHDAPQSLPQPFSVKIPVGDRHILVETGHIGRQASGSVTVTDGETIVYTSV
CLDDVPSEPSDFYPLSVNYQERFSAAGRTSGGFFKREGKLKDHEVLICRLIDRPLRPTMF
KGFYHETQILSWVLSYDGLHSPDSLAVTAAGIAVALSEVPNTKVIAGVRVGLVDNKFIVN
PTTKEMEESELDLLLAGTDSAIFMIEGYCNFLTEEKLLDAVQIGQDAVRAICNEVGVLVK
KCGKAKMLDAIKLPPAELYKHVEEIAGDELVKILQITSKVPRRKALASLEEKVLSILTEK
GYVSKDERFGTPETVADLLEVEDEDEEIVVDGEVDEGDVHIKPIGRKFSPLLFSEVDVKL
VFKEVTSKFLRKRIVEGGKRSDGRTPDRIRPIDSRCGILPRAHGSALFTRGETQSLAVVT
LGDKQMAQRVDNLVDEEEFKRFYLQYLFPPSCVGEVGRIGAPSRREIGHGMLVERALKPI
LPSDDDFPYTVRVESTITESNGSSSMASVCGGCLALQDAGVPVKCMIAGIAMGMVLDTEE
FGGDGTPLILSDITGSEDASGDMDFKVAGNEDGITAFQMDIKVGGITLPVMRKALLQARD
GRQHILAEMLKCSPFPSERLSKYAPLIHIMKVNPKKVNIIIGSGGKKVKSIIEETGVEAI
DTREDGIVKITAKDLSSIEKSKSIINQLTMVPNVGDIYRHVLSLSCFSLNCEIKSVAPYG
VFVEIAPGRE
Download sequence
Identical sequences 3694.gw1.XIX.1195.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]