SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 369723.Strop_1381 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  369723.Strop_1381
Domain Number 1 Region: 13-153
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-46
Family Ribonuclease PH domain 1-like 0.000000656
Further Details:      
 
Domain Number 2 Region: 321-517
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.13e-43
Family Ribonuclease PH domain 1-like 0.000000568
Further Details:      
 
Domain Number 3 Region: 154-262
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.32e-26
Family Ribonuclease PH domain 2-like 0.00000811
Further Details:      
 
Domain Number 4 Region: 476-574
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.59e-24
Family Ribonuclease PH domain 2-like 0.0000235
Further Details:      
 
Domain Number 5 Region: 584-670
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.43e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 6 Region: 266-346
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.88e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0001
Further Details:      
 
Domain Number 7 Region: 648-723
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.58e-16
Family Cold shock DNA-binding domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 369723.Strop_1381
Sequence length 785
Comment (Salinispora tropica CNB-440)
Sequence
MTESNLGTESRTATIDNGAFGTRVITFSTGRLARQAAGSVVAQLGETVVLSATTVGRQPK
EHFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSEDAILTCRLIDRPLRPSFVKGLRNEV
QVVETVLALDPSHPYDVVAINAASMSTKLSGLPFSGPIGATRMAHIDGSWVAFPTHEELV
RATFDMVVAGRALPDGDVAIMMVEAEATAHTAKLVADGASAPTEEVVASGLEAAKPAIRE
LCRAQSELAEVAAKPVAEFPVFLDYSDDVYDAVTELAREDVAEALKIAGKADREEALDRI
KARAVEELGPRFEGREKELSAALRSLTKSEVRSRVLREQVRIDGRGPRDIRPLTAEVGVL
PRVHGSALFERGETQIMGVTTLNMLRMEQSLDTLSPEKSKRYMHNYNFPPYSTGETGRVG
SPKRREIGHGALAERALIPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCASTLGLLSAG
VPLKAPVAGIAMGLISDEVEGKTRYVTLTDILGAEDAFGDMDFKVAGTQEFVTALQLDTK
LDGIPSDVLAAALQQAYEARQTILEVMQAAIEAPATMSDYAPRVTTVKIPVDKIGMVIGP
KGQTINAIQDETGAEISIEDDGTIYVGATNGPAAQAAVERINGIANPTLPKVGDRFLGTV
VKTAAFGAFISLLPGRDGLLHISKVGDGKRVEKVEDFLNVGDKVEVEIADIDQRGKIYLD
KVRPEGAEAPAEGAAERPAGRDRGDRGPRDRGDRGGRGPDRGDSGDGGDGGEGGESRPRR
RTRRS
Download sequence
Identical sequences A4X4P8
369723.Strop_1381 WP_011905280.1.12452 WP_011905280.1.28039 WP_011905280.1.3277 WP_011905280.1.3377 WP_011905280.1.34286 WP_011905280.1.43425 WP_011905280.1.57249 WP_011905280.1.65288 WP_011905280.1.69032 WP_011905280.1.88928 WP_011905280.1.9676 gi|145593929|ref|YP_001158226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]