SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT1G11400.3-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT1G11400.3-P
Domain Number 1 Region: 20-48
Classification Level Classification E-value
Superfamily Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain 0.00000000745
Family Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain 0.0034
Further Details:      
 
Weak hits

Sequence:  3702.AT1G11400.3-P
Domain Number - Region: 135-201
Classification Level Classification E-value
Superfamily Fibritin 0.051
Family Fibritin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT1G11400.3-P
Sequence length 204
Comment (Arabidopsis thaliana)
Sequence
MGSRSGEQGKRMAELSKNLKEGERILEPTRRPDGTLRKPIRIRPGYTPEDEVVKYQSKGS
LMKKEMASQGPPGYEPDPAPKPKTKAAKRNERKKEKRLQATAEKANSSEDGSASNGSQSV
NVLASEMEALDVSSNNDVCGGAPNPGTTGEDVEKRIRALKKKIRLTEAQQQKTASRDLNP
EQLEKFSKLEEWRQELKALEDKAA
Download sequence
Identical sequences A0A178W3L1 Q9LPZ4
NP_001031023.1.80155 NP_001322144.1.80155 NP_001322145.1.80155 NP_001322146.1.80155 NP_563890.1.80155 NP_849639.1.80155 AT1G11400.1 3702.AT1G11400.3-P AT1G11400.1 AT1G11400.2 AT1G11400.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]