SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT1G32700.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3702.AT1G32700.1-P
Domain Number - Region: 34-68
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00403
Family B-box zinc-binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3702.AT1G32700.1-P
Sequence length 213
Comment (Arabidopsis thaliana)
Sequence
MGAEEETNKTYPHWLKPLLREKFFVQCKLHADSHKSECNMYCLDCTNGPLCSLCLSFHKD
HHAIQIRRSSYHDVIRVSEIQKFLDITGVQTYVINSAKVVFLNERPQPRPGKGVINTCEV
CYRSLVDSFRFCSLGCKISGISKKKRKEWTNNLSDSDDSYSSTSIGRLKKNDDIMNNSFT
PSTPPLSAVNRRIAKRRKGIPHRAPFGGLIIEY
Download sequence
Identical sequences F4IEB6
AT1G32700.1 AT1G32700.1 NP_564406.1.80155 3702.AT1G32700.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]