SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT1G63640.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT1G63640.1-P
Domain Number 1 Region: 472-837
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-116
Family Motor proteins 0.00000103
Further Details:      
 
Domain Number 2 Region: 43-138
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-16
Family Calponin-homology domain, CH-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT1G63640.1-P
Sequence length 1071
Comment (Arabidopsis thaliana)
Sequence
MSSHLSQDANMNGVYVRSDVSSMLSFDGSESRESMDDSKKGHQSLVEWLNETLPYLKLPW
EASEDELRACLRDGTVLCSLLNQLSPGSMRMGGSFEPASVKIERFLTAMDEMALPRFEVS
DIEQGDMVPVLQSLKALKASFSDGSYDKNSLAARRRWSLPEDHSDSRGDDRNFTDGFQSK
EGSEIDMSDAKISDLLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAMASLLSALV
QVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLESLAAGTTKENEIVTNCMEHIKLEK
TRIEEKERSEEKDVVRLRKEKERSDAEIRQLKQELKLVKETHENQCLELEAKAQKTRDEL
EKKLKDAELHVVDSSRKVKELEKLCQSKSQRWEKKECIYQNFIDNHSGALQELSATSLSI
KHEVVRTQRKYFEDLNYYGLKLKGVADAAKNYHVVLEENRRLYNEVQELKGNIRVYCRIR
PFLPGQNSRQTTIEYIGETGELVVANPFKQGKDTHRLFKFNKVFDQAATQEEVFLDTRPL
IRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFLLTQSRQNTVMY
EVGVQMVEIYNEQVRDILSDGGSSRRLGIWNTALPNGLAVPDASMHCVRSTEDVLELMNI
GLMNRTVGATALNERSSRSHCVLSVHVRGVDVETDSILRGSLHLVDLAGSERVDRSEATG
ERLKEAQHINKSLSALGDVIFALAHKNPHVPYRNSKLTQVLQSSLGGQAKTLMFVQVNPD
GDSYAETVSTLKFAERVSGVELGAAKSSKEGRDVRQLMEQVSNLKDVIAKKDEELQNFQK
VKGNNATSLKRGLSNLRLVGPTSPRRHSIGASPNARRGKASGLFGRGTSDVDNCSEYSSK
HSDSGSQQSSDERKHQKDYHQPSKFAGAAKGIDFDDEDVELVGLADADSEDRLSDISDSC
LSMGTETDGSISSAVELTLFPETAKPLELIERPEARMTSEKLEKSVKMGKTEPKDRTNIP
SKIPKQTLKPPGQTRPSRLSIATSSSSKALTGAKRPTISTSSSAKPLNRRR
Download sequence
Identical sequences B3H6Z8
3702.AT1G63640.1-P AT1G63640.1 AT1G63640.1 NP_001322194.1.80155 NP_176551.3.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]