SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT1G72920.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT1G72920.1-P
Domain Number 1 Region: 5-149
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.57e-38
Family Toll/Interleukin receptor TIR domain 0.0046
Further Details:      
 
Weak hits

Sequence:  3702.AT1G72920.1-P
Domain Number - Region: 171-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00292
Family ABC transporter ATPase domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT1G72920.1-P
Sequence length 275
Comment (Arabidopsis thaliana)
Sequence
MSSPTATKYDVFLSFRGLDTRRNFISFLYKELVRRKIRTFKDDKELENGRRISPELKRAI
EESKFAVVVVSVNYAASPWCLDELVKIMDFENKGSITVMPIFYGVDPCHLRRQIGDVAEQ
FKKHEAREEDHEKVASWRRALTSLASISGECSLKWEDEANLVDEIADKISKNLMTVTTIS
NGRDLVGIDTHMKALNKKLDLNSNKSLRVVGIWARGYNGRSALAKYVYQDICHWLKVGWL
KVYQDIKTASKLYVLTRWLKVAHLLHRSHHSFKTE
Download sequence
Identical sequences Q9SSN4
AT1G72920.1 3702.AT1G72920.1-P NP_177435.1.80155 AT1G72920.1 GO.3479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]