SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT2G04750.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT2G04750.1-P
Domain Number 1 Region: 114-614
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.02e-164
Family Calponin-homology domain, CH-domain 0.00000000000113
Further Details:      
 
Weak hits

Sequence:  3702.AT2G04750.1-P
Domain Number - Region: 12-93
Classification Level Classification E-value
Superfamily EF-hand 0.00198
Family Calmodulin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3702.AT2G04750.1-P
Sequence length 652
Comment (Arabidopsis thaliana)
Sequence
MSSYVGVLVSDPWLQSQFTQVELRTLKSKFYSTKTRFGRVTVKHLPPVFAKLKYFNGKFD
ENEIKTILDESYPNRAKEVEFETFLRAFLSVQSRGSKGASSFLKTSTTTFHHSINESEKA
SYVSHINSYLKDEPNLKSYLPINPTTNALFDLVKDGVLLCKLINIAVPGTIDERAINTKK
ELNPWERTENLSLCLNSAKAIGCTVVNIGTQDIAEGTPHLVLGLIFQIIKIQLLADLNLK
KTPQLVELVEENQDVEELMGLAPEKLLLKWMNFHLKKAGYEKQVTNFSSDVKDGEAYAYL
LNALAPEHSTNVTLEIKDPSERATKVLEQAEKLDCKRFLSPKDIVEGSANLNLAFVAQLF
HHRNGLSDESPKVPISVAEMVTEDEETSREERCFRHWMNSLGAVTYVDNVFEDVRNGWVL
LEVLDKVSPGSVNWKHANKPPIKMPFKKVENCNQVIKIGKELNFSLVNVAGHDIMQGNKK
LLLAFLWQLMRYTMLQILNNLRSHCQGKDITEADILNWANRKVKKSGRTSQAVSFKDKNL
ANGIFFLELLSAVEPRVVNWSLVSKGETQEEKNLNATYIISVARKLGCSIFLLPEDILEV
NQRMMLILAASIMNWSLQQQSDTESTVSDDTDVSSVTEEISNLSTDDGSSDV
Download sequence
Identical sequences A0A178VSU4 Q9SJ84
NP_178552.1.80155 AT2G04750.1 AT2G04750.1 3702.AT2G04750.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]