SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT3G03710.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT3G03710.1-P
Domain Number 1 Region: 428-625
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-45
Family Ribonuclease PH domain 1-like 0.0000313
Further Details:      
 
Domain Number 2 Region: 86-227
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.64e-39
Family Ribonuclease PH domain 1-like 0.0000625
Further Details:      
 
Domain Number 3 Region: 583-682
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.02e-23
Family Ribonuclease PH domain 2-like 0.00024
Further Details:      
 
Domain Number 4 Region: 231-314
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.8e-22
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 5 Region: 759-835
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.72e-16
Family Cold shock DNA-binding domain-like 0.0018
Further Details:      
 
Domain Number 6 Region: 695-780
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000097
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 7 Region: 322-369
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000157
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT3G03710.1-P
Sequence length 922
Comment (Arabidopsis thaliana)
Sequence
MLTSPSNALHSSTPQFWPLRRSKLCRSRNFPRFHSGERSSGGGGKLCSLSLLSGSGAGKF
SVRALVRPDDTDDADSVGDGSLAFPNHVSVKIPFGNREILVETGLMGRQASSAVTVTDGE
TIVYTSVCLADVPSEPSDFLPLYVHYQERFSAVGRTSGGFFKREGRTKDHEVLICRLIDR
PLRPTMPKGFYNETQILSWVLSYDGLHAPDALAVTSAGIAVALSEVPNAKAIAGVRVGLI
GGEFIVNPTVKEMEESQLDLFLAGTDTAILTIEGYSNFLPEEMLLQAVKVGQDAVQATCI
AIEVLAKKYGKPKMLDAIRLPPPELYKHVKELAGEELTKALQIKSKISRRKAISSLEEKV
LTILTEKGYVIDEVAFGTIEAQPDLLEDEDEDEEVVPEGEVDQGDVHIRPIPRKPIPLLF
SEVDVKLVFKEVSSKLLRRRIVEGGKRSDGRTLDEIRPINSRCGLLPRAHGSTLFTRGET
QALAVVTLGDKQMAQRIDNLEGSDEYKRFYLQYTFPPSSVGEVGRIGAPSRREIGHGTLA
ERALETILPSDDDFPYTIRVESTVIESNGSSSMASVCGGCLALQDAGVPVKCSVAGIAMG
MVWDTEEFGGDGSPLILSDITGAEDASGDMDFKVAGNEDGVTAFQMDIKVGGITLEIMEK
ALIQAKAGRRHILAEMAKCSPPPTLSLSKYAPLILIMKVHPSKVYSLIGSGGKKVKSIIE
ESGVEAIDMQDDGTVKIMAIDVASLERAKAIISGLTMVPSVGDIYRNCEIKSMAPYGAFV
EIAPGREGLCHISELSAEWLAKPEDAYKVGDRIDVKLIEVNEKGQLRLSVRALLPESETD
KDSQKQQPAGDSTKDKSSQRKYVNTSSKDRAAAGASKVSSGDELVLKKKDVRRATGGSSD
KTMNSNSSTNEESLVNGEATIS
Download sequence
Identical sequences Q8GZQ3
3702.AT3G03710.1-P NP_187021.2.80155 AT3G03710.1 AT3G03710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]