SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT3G10310.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT3G10310.1-P
Domain Number 1 Region: 327-651
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.49e-104
Family Motor proteins 0.00000181
Further Details:      
 
Domain Number 2 Region: 15-151
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.55e-23
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT3G10310.1-P
Sequence length 922
Comment (Arabidopsis thaliana)
Sequence
MTTGLHEFNLASRRAEEAAARRFQAVQWLKSVVGQLGIPNQPSEKEFISCLRNGMILCNA
INKIHPGAVSKVVENYSYLNGEYQLPPAYQYFENVRNFLVALETLRLPGFEASDLEKDNL
ESGSVTKVVDCILGLKAYHECKLPSNGNGLYKHVKTPTFQLSATKIHPTLSASKTSRHLD
MSSVRERNDCTDGESDKLKGIAKLFADHIFSSKENIDENLVSLENGSENSRANFEKILSR
FPELQSVFKNLLSEGTLKPSDLKSMPLEELPVHEEDQSSRSLSHKTKCNHKRLLKTQEKE
LAVLKNLFIKTKQDFKEFQVYLQRDLMELGNQMQEMSSAAQGYYKVVEENRKLYNMVQDL
KGNIRVYCRVRPIFNSEMDGVIDYIGKDGSLFVLDPSKPYKDARKTFQFNQVFGPTATQD
DVFRETQPLIRSVMDGYNVCIFAYGQTGSGKTYTMSGPPGRSATEMGINYLALSDLFLIY
IRTCSSDDDGLSLPDATMHSVNSTKDVLQLMEAGEVNRAVSSTSMNNRSSRSHSIFMVHV
RGKDTSGGTLRSCLHLVDLAGSERVDKSEVTGDRLKEAQYINKSLSCLGDVISALAQKNS
HIPYRNSKLTLLLQDSLGGQAKTLMFAHLSPEEDSFGETISTLKFAQRVSTVELGAARAH
KETREVMHLKEQIENLKRALGTEEWNNVSNGSKEIKSPFSRPIATTERTPPRLRRLSIEN
CSSTKANLEDRRGIKSPLASRRAQILSLEGPMSCKNEENGKGDPTMEVHQLKNPRSPLSS
YQNRAVKVDGRTSIPQLQLLQTPVKGASRNDIQMISVDSKTNGKGSHIRKSLRTIGKLIN
GSEKRKENIPADPRSPLGVANNFSHIKSPDTSNAKTMRRQSLTGVMPPGQERSRRSSIGG
KPIENGKKDHVFTPFRLNKFNN
Download sequence
Identical sequences AT3G10310.1 3702.AT3G10310.1-P AT3G10310.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]