SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT3G29390.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT3G29390.1-P
Domain Number 1 Region: 194-314
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 
Weak hits

Sequence:  3702.AT3G29390.1-P
Domain Number - Region: 109-177
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00293
Family Eukaryotic type KH-domain (KH-domain type I) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3702.AT3G29390.1-P
Sequence length 578
Comment (Arabidopsis thaliana)
Sequence
MTEDNDEARVPLSDSSTTNDASRTRQRRKRKWDKPAEQLVAAGVAFPQLLPLGNTMNVPS
MSPLLQTLSVPLAVPKVNQPKIQDEVIIAREIVINDAEASLRHRLTKRSTQEDIQRSTGA
VVITRGKYRPPNAPPDGEKPLYLHISAAAQLQLKETTERILAVDRAAAMIEEMMKQKSIS
QIGSVGLQTVKMLSTCVYLGFEADPSSNVAARIRGPNDQYINHIMNETGATVVLRGRGSG
SLENQHGDEAQLPLHLLLSGSNPKSIDDAKRLAENLMDTISVEFGASRVSSSKVYGAVPP
PQQLISGAPGSDQENQNLISTYGLMTSIPITAPPYAVSSFPVTPATSLYPQFPVMQSLGI
SNGGPSQPVAGGTSYSGYAGIYPQATPLQQVAQVLKQSISPVISTVPPTMLTATSLSIPS
DNASNEMERRPPRKRKFQELPADCKVPEKDKQQSELAMTGDVTPSANRVRSPPSPRSVMP
PPPPKTIAPPPSKTMSPPSSKSMLPPPPRSKTMSPLSSKSMLPPPPRFTLTTQRSRLQDN
HISVKKPNPVPDTLIKLMEYGDDEDDDDDPDEPLTTRS
Download sequence
Identical sequences Q9LIA4
NP_566850.3.80155 AT3G29390.1 3702.AT3G29390.1-P AT3G29390.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]