SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT4G10070.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT4G10070.1-P
Domain Number 1 Region: 271-345
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 167-252
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.28e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3702.AT4G10070.1-P
Sequence length 725
Comment (Arabidopsis thaliana)
Sequence
MTEEDFVVISTPPVDLKRKLDEVELNGNIVDDSNQTSDSSQAKRAKLEDEAQDGLDYGNT
QENGSSMEVKEEEQLQEPKEENQDSVPLVEEVQDPIHADESENKICSVDQPTDDQVKPED
NQQGCIEDVNGGEHQKVIDDDSKEVNDGSSQENGKEENKEVDGEKSQKEVDGTQSTTRRI
DVPSSKVGVLIGKGGETIRYLQFNSGAKIQILRDSEADPSSALRPVEIIGSVACIESAEK
LISAVIAEAEAGGSPALVARGHPSTHAIGIPEQIEIKVPNDKVGLIIGRGGETIKNMQTR
SGARTQLIPQHAEGDGLKERTVRISGDKMQIDIATDMIKDVMNQNARPSSYSGGYNQPAY
RPQGPGGPPQWGSRGPHAPHPYDYHPRGPYSSQGSYYNSPGFGGYPPQHMPPRGGYGTDW
DQRPPYSGPYNYYGRQGAQSAGPVPPPSGPVPSPAFGGPPLSQVSYGYGQSHGPEYGHAA
PYSQTGYQQTYGQTYEQPKYDSNPPMQPPYGGSYPPAGGGQSGYYQMQQPGVRPYGMQQG
PVQQGYGPPQPAAAASSGDVPYQGATPAAPSYGSTNMAPQQQQYGYTSSDGPVQQQTYPS
YSSAPPSDAYNNGTQTPATGPAYQQQSVQPASSTYDQTGAQQAAAAGYGGQVAPTGGYTY
PTSQPAYGSQAAYSQAAPTQTGYEQQPATQAAVYATAPGTAPVKTQSPQSAYAQYDASQV
YATPR
Download sequence
Identical sequences AT4G10070.1 AT4G10070.1 3702.AT4G10070.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]