SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT4G32175.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT4G32175.1-P
Domain Number 1 Region: 70-162
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.47e-20
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 158-236
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.25e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00081
Further Details:      
 
Domain Number 3 Region: 9-70
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 6.02e-17
Family ECR1 N-terminal domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3702.AT4G32175.1-P
Sequence length 241
Comment (Arabidopsis thaliana)
Sequence
MAAKVSVSPTSLLNQIVVPGDVVLDLSNMNNQTIKLGSGLLQDNDAISAMRAGKLSYSKP
NKYWLESSHKRYIPRPDDHVLGIVVDSRADNFWVDIKGPQLALLPVLAFEGGTRRNIPKF
EVGTLLYLRVVKTNIGMNPELSCTEASGKAALFGPLRDGFMFETSTGLSRMLLNSPTRPV
IEALGKKLSFEIAVGLNGRVWVNATAPRIVIIVANAIMNSESLSGTQQRIMVEKLLAIIS
D
Download sequence
Identical sequences Q500X1
AT4G32175.1 3702.AT4G32175.1-P AT4G32175.1 NP_680755.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]