SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT5G35923.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3702.AT5G35923.1-P
Domain Number - Region: 43-113
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0068
Family Clostridium neurotoxins, "coiled-coil" domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3702.AT5G35923.1-P
Sequence length 194
Comment (Arabidopsis thaliana)
Sequence
VIGTSNREPLSFGFLGEVVYVNWLSGDSFKLILFPLSLREKASQWLKTIPSHLVSSWDAC
KKIILLKFYSKQKTTKVKSDIIGFKQGINESFHEAWGRLNDYTQDCPPGFKRKLFPYLYC
GVNKELKLSLDMTSKRFANITMDGELLVENLAQSDLSYNEICDRIAFGDTKRLHMEKIAK
SIRVEKFMMMQERG
Download sequence
Identical sequences 3702.AT5G35923.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]