SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT5G56840.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT5G56840.1-P
Domain Number 1 Region: 87-141
Classification Level Classification E-value
Superfamily Homeodomain-like 5.31e-16
Family Myb/SANT domain 0.064
Further Details:      
 
Weak hits

Sequence:  3702.AT5G56840.1-P
Domain Number - Region: 3-23
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00251
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 
Domain Number - Region: 40-46
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0575
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT5G56840.1-P
Sequence length 233
Comment (Arabidopsis thaliana)
Sequence
MGRRCSHCGNVGHNSRTCSSYQTRVVRLFGVHLDTTSSSPPPPPPPSILAAAIKKSFSMD
CLPACSSSSSSFAGYLSDGLAHKTPDRKKGVPWTAEEHRTFLIGLEKLGKGDWRGISRNF
VVTKSPTQVASHAQKYFLRQTTTLHHKRRRTSLFDMVSAGNVEENSTTKRICNDHIGSSS
KVVWKQGLLNPRLGYPDPKVSVSGSGNSGGLDLELKLASIQSPESNIRPISVT
Download sequence
Identical sequences A0A178UGL6 Q9FJS9
3702.AT5G56840.1-P AT5G56840.1 NP_200495.1.80155 AT5G56840.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]