SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT5G57150.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT5G57150.1-P
Domain Number 1 Region: 53-116
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.71e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  3702.AT5G57150.1-P
Domain Number - Region: 164-225
Classification Level Classification E-value
Superfamily ACT-like 0.000641
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT5G57150.1-P
Sequence length 247
Comment (Arabidopsis thaliana)
Sequence
MEDIVDQELSNYWEPSSFLQNEDFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSER
NRRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIEGLQYEEKKLEAEIRELESTPKSS
LSFSKDFDRDLLVPVTSKKMKQLDSGSSTSLIEVLELKVTFMGERTMVVSVTCNKRTDTM
VKLCEVFESLNLKILTSNLTSFSGMIFHTVFIEADEEEQEVLRLKIETGIGAYNETQSPT
LSIDSLY
Download sequence
Identical sequences F4KAJ4
3702.AT5G57150.1-P AT5G57150.1 NP_568850.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]