SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 370552.MGAS10270_Spy1790 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  370552.MGAS10270_Spy1790
Domain Number 1 Region: 312-457
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.33e-21
Family Histidine kinase 0.0041
Further Details:      
 
Domain Number 2 Region: 228-306
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000314
Family Homodimeric domain of signal transducing histidine kinase 0.0032
Further Details:      
 
Weak hits

Sequence:  370552.MGAS10270_Spy1790
Domain Number - Region: 177-225
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000314
Family HAMP domain 0.0066
Further Details:      
 
Domain Number - Region: 34-84
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.0459
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 370552.MGAS10270_Spy1790
Sequence length 462
Comment (Streptococcus pyogenes MGAS10270)
Sequence
MRLIKKTFLVINGLIIVVVTSILLVLYFAMPIYYTKVKDKEVKREFDQTSKQIKGKTVTE
IRDILTKKINKDNIWYSLVDSDNQLLYPSLQLLDGVSESKDSQNVNIVTTFDNSYSNVKV
MSQKVTLRDGKKMTLLGQSSLQPVTDASKVLLDLYPSLLMFSVTVGSIVAYLYSRTSSRR
ILSMSQTAKKMVNLEPNLTCTIHGKDEIAMLASDINRLYASLSTSIKSLQKEYEKASDSE
REKSEFLRMTSHELKTPITSVIGMIDGMLYNVGDFADRDKYLRKCRDVLEGQAQLVQSIL
SLSKIETLASQNQELFSLKSSLEEEMEVFLVLSELKHLKVTINLEEQFVKANKVYLLKAI
KNIIDNAFHYTKSGGQVMIQLKDNQLVIKNEAETLLTQQQMKQLFQPFYRPDYSRNRKDG
GTGLGLFITHQILDQHHLAYRFVVLDQRWMVFTIDFPSHHDD
Download sequence
Identical sequences Q1JEQ4 Q48R42
gi|94991299|ref|YP_599399.1| 319701.M28_Spy1708 370552.MGAS10270_Spy1790 WP_011285225.1.1526 WP_011285225.1.21068 WP_011285225.1.26775 WP_011285225.1.31038 WP_011285225.1.39740 WP_011285225.1.41398 WP_011285225.1.55040 WP_011285225.1.58073 WP_011285225.1.58327 WP_011285225.1.61350 WP_011285225.1.66344 WP_011285225.1.68302 WP_011285225.1.74388 WP_011285225.1.7902 WP_011285225.1.81017 WP_011285225.1.94718 gi|71904370|ref|YP_281173.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]