SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 373384.SFV_3194 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  373384.SFV_3194
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.99e-50
Family Ribonuclease PH domain 1-like 0.0000141
Further Details:      
 
Domain Number 2 Region: 301-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.68e-46
Family Ribonuclease PH domain 1-like 0.0000178
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-31
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 450-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.95e-27
Family Ribonuclease PH domain 2-like 0.0000828
Further Details:      
 
Domain Number 5 Region: 226-325
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.15e-25
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 6 Region: 608-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.63e-23
Family Cold shock DNA-binding domain-like 0.0000219
Further Details:      
 
Domain Number 7 Region: 554-622
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.29e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 373384.SFV_3194
Sequence length 711
Comment (Shigella flexneri 5 8401)
Sequence
MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLT
VNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDRPIRPLFPEGFVNEVQVIATVVSV
NPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVA
GTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQPEPVNE
ALNARVAALAEARLSDAYRITDKQERYAQVDVIKSETIATLLAEDETLDENELGEILHAI
EKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTAR
DAQVLDELMGERTDTFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAVMPDMDK
FPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSD
ILGDEDHLGDMDFKVAGSREGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQA
INAPRGDISEFAPRIHTIKINPDKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVKIAAT
DGEKAKHAIRRIEEITAEIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVE
KVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEATEQSQPAAAPEAPAAEQGE
Download sequence
Identical sequences A0A027U0D0 A0A028AIT2 A0A028EDE5 A0A0F3VAX2 A0A0F6MIB9 A0A127GPY3 A0A200LKY8 A0A226KF19 A0A233DRV6 E7SIQ7 F5N7I7 F5P066 I2RZG0 I2UHG1 I4T330 I6FKP6 I6HD76 K4X9T2 K4XPP0 Q0T0B7 Q83JG0 V8FIV3
gi|110807033|ref|YP_690553.1| WP_001297425.1.100425 WP_001297425.1.100543 WP_001297425.1.10067 WP_001297425.1.10068 WP_001297425.1.100752 WP_001297425.1.100836 WP_001297425.1.101157 WP_001297425.1.101216 WP_001297425.1.101289 WP_001297425.1.101418 WP_001297425.1.101436 WP_001297425.1.101468 WP_001297425.1.101522 WP_001297425.1.10154 WP_001297425.1.101545 WP_001297425.1.101630 WP_001297425.1.101653 WP_001297425.1.101667 WP_001297425.1.101668 WP_001297425.1.101786 WP_001297425.1.101840 WP_001297425.1.101913 WP_001297425.1.101952 WP_001297425.1.101964 WP_001297425.1.102069 WP_001297425.1.102122 WP_001297425.1.10226 WP_001297425.1.10361 WP_001297425.1.10461 WP_001297425.1.10538 WP_001297425.1.10579 WP_001297425.1.10607 WP_001297425.1.10651 WP_001297425.1.10763 WP_001297425.1.10798 WP_001297425.1.11616 WP_001297425.1.11759 WP_001297425.1.11912 WP_001297425.1.11949 WP_001297425.1.12645 WP_001297425.1.12693 WP_001297425.1.12743 WP_001297425.1.12749 WP_001297425.1.1295 WP_001297425.1.12965 WP_001297425.1.13157 WP_001297425.1.13222 WP_001297425.1.13301 WP_001297425.1.1335 WP_001297425.1.13451 WP_001297425.1.13867 WP_001297425.1.14058 WP_001297425.1.14062 WP_001297425.1.14693 WP_001297425.1.15138 WP_001297425.1.1524 WP_001297425.1.15335 WP_001297425.1.15593 WP_001297425.1.1582 WP_001297425.1.15916 WP_001297425.1.1640 WP_001297425.1.16517 WP_001297425.1.17111 WP_001297425.1.17464 WP_001297425.1.1754 WP_001297425.1.17623 WP_001297425.1.17637 WP_001297425.1.17680 WP_001297425.1.17711 WP_001297425.1.17963 WP_001297425.1.18436 WP_001297425.1.18438 WP_001297425.1.18458 WP_001297425.1.18519 WP_001297425.1.1866 WP_001297425.1.18929 WP_001297425.1.19024 WP_001297425.1.19148 WP_001297425.1.19332 WP_001297425.1.19453 WP_001297425.1.19494 WP_001297425.1.19583 WP_001297425.1.20136 WP_001297425.1.2015 WP_001297425.1.20277 WP_001297425.1.20334 WP_001297425.1.20484 WP_001297425.1.20630 WP_001297425.1.21029 WP_001297425.1.21137 WP_001297425.1.21441 WP_001297425.1.21667 WP_001297425.1.21732 WP_001297425.1.21887 WP_001297425.1.21992 WP_001297425.1.22098 WP_001297425.1.22204 WP_001297425.1.22291 WP_001297425.1.22328 WP_001297425.1.22409 WP_001297425.1.22522 WP_001297425.1.22544 WP_001297425.1.22771 WP_001297425.1.22868 WP_001297425.1.22896 WP_001297425.1.23042 WP_001297425.1.23078 WP_001297425.1.23520 WP_001297425.1.23527 WP_001297425.1.23593 WP_001297425.1.23622 WP_001297425.1.23693 WP_001297425.1.23741 WP_001297425.1.23754 WP_001297425.1.2395 WP_001297425.1.23970 WP_001297425.1.24024 WP_001297425.1.24233 WP_001297425.1.2433 WP_001297425.1.24460 WP_001297425.1.24547 WP_001297425.1.24646 WP_001297425.1.25019 WP_001297425.1.25038 WP_001297425.1.25378 WP_001297425.1.25592 WP_001297425.1.25613 WP_001297425.1.25799 WP_001297425.1.25886 WP_001297425.1.26005 WP_001297425.1.26186 WP_001297425.1.26325 WP_001297425.1.26736 WP_001297425.1.27148 WP_001297425.1.27292 WP_001297425.1.2731 WP_001297425.1.27424 WP_001297425.1.27472 WP_001297425.1.27691 WP_001297425.1.27897 WP_001297425.1.2823 WP_001297425.1.28491 WP_001297425.1.29082 WP_001297425.1.2931 WP_001297425.1.29504 WP_001297425.1.29669 WP_001297425.1.29798 WP_001297425.1.29876 WP_001297425.1.30035 WP_001297425.1.30391 WP_001297425.1.30640 WP_001297425.1.31319 WP_001297425.1.31340 WP_001297425.1.31357 WP_001297425.1.31518 WP_001297425.1.31618 WP_001297425.1.31866 WP_001297425.1.32037 WP_001297425.1.32094 WP_001297425.1.32142 WP_001297425.1.32287 WP_001297425.1.3247 WP_001297425.1.32475 WP_001297425.1.32655 WP_001297425.1.32831 WP_001297425.1.32995 WP_001297425.1.3354 WP_001297425.1.33680 WP_001297425.1.33914 WP_001297425.1.3444 WP_001297425.1.34855 WP_001297425.1.35006 WP_001297425.1.35316 WP_001297425.1.35368 WP_001297425.1.3539 WP_001297425.1.35649 WP_001297425.1.35698 WP_001297425.1.35927 WP_001297425.1.36129 WP_001297425.1.36166 WP_001297425.1.36177 WP_001297425.1.36500 WP_001297425.1.36628 WP_001297425.1.37046 WP_001297425.1.37155 WP_001297425.1.37510 WP_001297425.1.37549 WP_001297425.1.37637 WP_001297425.1.3772 WP_001297425.1.37730 WP_001297425.1.37830 WP_001297425.1.37847 WP_001297425.1.37917 WP_001297425.1.37995 WP_001297425.1.38033 WP_001297425.1.38103 WP_001297425.1.38119 WP_001297425.1.38202 WP_001297425.1.38626 WP_001297425.1.39005 WP_001297425.1.39037 WP_001297425.1.39063 WP_001297425.1.39103 WP_001297425.1.39123 WP_001297425.1.39286 WP_001297425.1.39358 WP_001297425.1.39626 WP_001297425.1.3970 WP_001297425.1.40206 WP_001297425.1.40249 WP_001297425.1.40382 WP_001297425.1.40865 WP_001297425.1.41037 WP_001297425.1.41125 WP_001297425.1.41315 WP_001297425.1.41339 WP_001297425.1.41372 WP_001297425.1.41391 WP_001297425.1.41392 WP_001297425.1.41449 WP_001297425.1.41455 WP_001297425.1.41466 WP_001297425.1.41479 WP_001297425.1.41513 WP_001297425.1.41613 WP_001297425.1.41964 WP_001297425.1.42038 WP_001297425.1.42138 WP_001297425.1.42203 WP_001297425.1.42387 WP_001297425.1.42442 WP_001297425.1.42456 WP_001297425.1.42748 WP_001297425.1.42832 WP_001297425.1.43133 WP_001297425.1.43166 WP_001297425.1.43316 WP_001297425.1.4342 WP_001297425.1.43561 WP_001297425.1.44018 WP_001297425.1.44077 WP_001297425.1.4415 WP_001297425.1.44222 WP_001297425.1.44285 WP_001297425.1.4445 WP_001297425.1.44627 WP_001297425.1.44671 WP_001297425.1.45000 WP_001297425.1.4535 WP_001297425.1.45392 WP_001297425.1.45799 WP_001297425.1.45931 WP_001297425.1.45949 WP_001297425.1.45960 WP_001297425.1.46070 WP_001297425.1.46105 WP_001297425.1.46429 WP_001297425.1.46433 WP_001297425.1.46477 WP_001297425.1.46555 WP_001297425.1.46614 WP_001297425.1.46668 WP_001297425.1.47034 WP_001297425.1.47198 WP_001297425.1.47473 WP_001297425.1.47662 WP_001297425.1.47775 WP_001297425.1.48077 WP_001297425.1.48433 WP_001297425.1.48571 WP_001297425.1.48801 WP_001297425.1.48954 WP_001297425.1.49107 WP_001297425.1.49229 WP_001297425.1.49336 WP_001297425.1.49712 WP_001297425.1.49823 WP_001297425.1.49856 WP_001297425.1.49950 WP_001297425.1.49987 WP_001297425.1.50119 WP_001297425.1.50182 WP_001297425.1.50258 WP_001297425.1.50939 WP_001297425.1.51175 WP_001297425.1.51260 WP_001297425.1.51278 WP_001297425.1.51299 WP_001297425.1.51323 WP_001297425.1.51537 WP_001297425.1.51760 WP_001297425.1.52272 WP_001297425.1.52406 WP_001297425.1.52419 WP_001297425.1.52777 WP_001297425.1.5291 WP_001297425.1.5322 WP_001297425.1.53251 WP_001297425.1.53356 WP_001297425.1.53401 WP_001297425.1.53537 WP_001297425.1.53841 WP_001297425.1.53866 WP_001297425.1.54091 WP_001297425.1.54307 WP_001297425.1.54755 WP_001297425.1.54798 WP_001297425.1.54989 WP_001297425.1.55070 WP_001297425.1.5520 WP_001297425.1.55291 WP_001297425.1.55357 WP_001297425.1.55844 WP_001297425.1.55988 WP_001297425.1.56358 WP_001297425.1.5646 WP_001297425.1.5670 WP_001297425.1.56835 WP_001297425.1.57150 WP_001297425.1.57185 WP_001297425.1.57348 WP_001297425.1.57812 WP_001297425.1.58022 WP_001297425.1.58128 WP_001297425.1.58172 WP_001297425.1.58408 WP_001297425.1.58901 WP_001297425.1.58977 WP_001297425.1.58983 WP_001297425.1.59119 WP_001297425.1.59165 WP_001297425.1.59190 WP_001297425.1.59226 WP_001297425.1.59782 WP_001297425.1.59791 WP_001297425.1.60342 WP_001297425.1.60387 WP_001297425.1.6059 WP_001297425.1.60606 WP_001297425.1.60835 WP_001297425.1.6110 WP_001297425.1.61112 WP_001297425.1.61948 WP_001297425.1.61957 WP_001297425.1.62282 WP_001297425.1.62487 WP_001297425.1.62514 WP_001297425.1.62529 WP_001297425.1.62851 WP_001297425.1.62914 WP_001297425.1.6299 WP_001297425.1.63350 WP_001297425.1.63437 WP_001297425.1.63612 WP_001297425.1.64014 WP_001297425.1.64050 WP_001297425.1.64074 WP_001297425.1.64153 WP_001297425.1.64356 WP_001297425.1.64793 WP_001297425.1.65484 WP_001297425.1.65662 WP_001297425.1.65962 WP_001297425.1.66059 WP_001297425.1.66187 WP_001297425.1.66288 WP_001297425.1.66795 WP_001297425.1.66978 WP_001297425.1.6701 WP_001297425.1.67018 WP_001297425.1.67102 WP_001297425.1.67116 WP_001297425.1.67194 WP_001297425.1.67278 WP_001297425.1.67412 WP_001297425.1.67802 WP_001297425.1.67841 WP_001297425.1.682 WP_001297425.1.68300 WP_001297425.1.6860 WP_001297425.1.68609 WP_001297425.1.68801 WP_001297425.1.6897 WP_001297425.1.69868 WP_001297425.1.70191 WP_001297425.1.70213 WP_001297425.1.70251 WP_001297425.1.70341 WP_001297425.1.70628 WP_001297425.1.70801 WP_001297425.1.71113 WP_001297425.1.71134 WP_001297425.1.71275 WP_001297425.1.71533 WP_001297425.1.71724 WP_001297425.1.71757 WP_001297425.1.71874 WP_001297425.1.72013 WP_001297425.1.72270 WP_001297425.1.72342 WP_001297425.1.72449 WP_001297425.1.72493 WP_001297425.1.72698 WP_001297425.1.72748 WP_001297425.1.72858 WP_001297425.1.73032 WP_001297425.1.73075 WP_001297425.1.73326 WP_001297425.1.73663 WP_001297425.1.73709 WP_001297425.1.73797 WP_001297425.1.7425 WP_001297425.1.74431 WP_001297425.1.74509 WP_001297425.1.74752 WP_001297425.1.74885 WP_001297425.1.75124 WP_001297425.1.75435 WP_001297425.1.75505 WP_001297425.1.75529 WP_001297425.1.75588 WP_001297425.1.75676 WP_001297425.1.76005 WP_001297425.1.76325 WP_001297425.1.76447 WP_001297425.1.76460 WP_001297425.1.76542 WP_001297425.1.76840 WP_001297425.1.76957 WP_001297425.1.76966 WP_001297425.1.77022 WP_001297425.1.77109 WP_001297425.1.77198 WP_001297425.1.77437 WP_001297425.1.77608 WP_001297425.1.78041 WP_001297425.1.78323 WP_001297425.1.78377 WP_001297425.1.78687 WP_001297425.1.78698 WP_001297425.1.78757 WP_001297425.1.78775 WP_001297425.1.79606 WP_001297425.1.79824 WP_001297425.1.79930 WP_001297425.1.80061 WP_001297425.1.80141 WP_001297425.1.80426 WP_001297425.1.80463 WP_001297425.1.8076 WP_001297425.1.80945 WP_001297425.1.80966 WP_001297425.1.810 WP_001297425.1.81036 WP_001297425.1.81376 WP_001297425.1.81391 WP_001297425.1.81517 WP_001297425.1.81582 WP_001297425.1.81876 WP_001297425.1.81956 WP_001297425.1.82242 WP_001297425.1.82507 WP_001297425.1.82572 WP_001297425.1.83286 WP_001297425.1.83321 WP_001297425.1.83340 WP_001297425.1.83807 WP_001297425.1.84140 WP_001297425.1.84164 WP_001297425.1.84668 WP_001297425.1.84881 WP_001297425.1.84941 WP_001297425.1.84986 WP_001297425.1.84990 WP_001297425.1.85008 WP_001297425.1.85085 WP_001297425.1.85416 WP_001297425.1.85762 WP_001297425.1.85944 WP_001297425.1.85969 WP_001297425.1.86451 WP_001297425.1.86483 WP_001297425.1.86681 WP_001297425.1.87075 WP_001297425.1.88535 WP_001297425.1.88631 WP_001297425.1.88709 WP_001297425.1.88735 WP_001297425.1.88883 WP_001297425.1.89067 WP_001297425.1.89255 WP_001297425.1.8928 WP_001297425.1.89479 WP_001297425.1.89818 WP_001297425.1.89839 WP_001297425.1.8985 WP_001297425.1.89998 WP_001297425.1.90065 WP_001297425.1.90314 WP_001297425.1.90856 WP_001297425.1.91266 WP_001297425.1.91414 WP_001297425.1.91485 WP_001297425.1.9185 WP_001297425.1.91863 WP_001297425.1.91971 WP_001297425.1.921 WP_001297425.1.92123 WP_001297425.1.92434 WP_001297425.1.9255 WP_001297425.1.92780 WP_001297425.1.93023 WP_001297425.1.93033 WP_001297425.1.93338 WP_001297425.1.93605 WP_001297425.1.93626 WP_001297425.1.94190 WP_001297425.1.94468 WP_001297425.1.94507 WP_001297425.1.94806 WP_001297425.1.9513 WP_001297425.1.95254 WP_001297425.1.95604 WP_001297425.1.95655 WP_001297425.1.95712 WP_001297425.1.95801 WP_001297425.1.95869 WP_001297425.1.96066 WP_001297425.1.96128 WP_001297425.1.96247 WP_001297425.1.96608 WP_001297425.1.96680 WP_001297425.1.96769 WP_001297425.1.96924 WP_001297425.1.96932 WP_001297425.1.97344 WP_001297425.1.97361 WP_001297425.1.97434 WP_001297425.1.97544 WP_001297425.1.97798 WP_001297425.1.97815 WP_001297425.1.9816 WP_001297425.1.98232 WP_001297425.1.98323 WP_001297425.1.98357 WP_001297425.1.98549 373384.SFV_3194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]