SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 373384.SFV_4210 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  373384.SFV_4210
Domain Number 1 Region: 14-133
Classification Level Classification E-value
Superfamily PapD-like 1.6e-40
Family Pilus chaperone 0.000000585
Further Details:      
 
Domain Number 2 Region: 128-213
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 1.57e-20
Family Periplasmic chaperone C-domain 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 373384.SFV_4210
Sequence length 218
Comment (Shigella flexneri 5 8401)
Sequence
MFMAMMVAGRAEAGVALGTTRVIYPAGQKQVQLAVTNNDENSTYLIQSWVENADGVKDGR
FIVTPPLFAMKGKKENTLRILDATNNQLPQDRESLFWMNVKAIPSMDKSKLTENMLQLAI
ISRIKLYYRPAKLALPPDQAAEKLRFRRSANSLTLINPTPYYLTVTELNAGTRVLENALV
PPMGESTVKLPSDAGSNITYRTINDYGALTPKMTGVME
Download sequence
Identical sequences A0A0F6MKQ7 Q0SXM1
gi|110807979|ref|YP_691499.1| 373384.SFV_4210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]