SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 373903.Hore_07900 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  373903.Hore_07900
Domain Number 1 Region: 296-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-51
Family Ribonuclease PH domain 1-like 0.00000961
Further Details:      
 
Domain Number 2 Region: 6-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.08e-43
Family Ribonuclease PH domain 1-like 0.0000195
Further Details:      
 
Domain Number 3 Region: 142-231
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.27e-29
Family Ribonuclease PH domain 2-like 0.00095
Further Details:      
 
Domain Number 4 Region: 456-555
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-28
Family Ribonuclease PH domain 2-like 0.0000891
Further Details:      
 
Domain Number 5 Region: 561-646
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.78e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 6 Region: 626-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.8e-23
Family Cold shock DNA-binding domain-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 373903.Hore_07900
Sequence length 705
Comment (Halothermothrix orenii H 168)
Sequence
MHKDWTIDVAGGKMKFETGKYAKQANGSVVARYGDTTVLVTATMSEPREGIDYFPLMVNY
EERVYAIGKIPGSITRREGRPRDVATLAARLIDRPLRPLFPEGFRHDVQIIATVLSVDND
CEPDILALNGASVALTLSDIPFDGPIGGVKVGLVDGELVINPDEEEREKSKLDLTVAGTR
DAVLMVEAGANEVSEDVMLDAIELAHQEIKRLVLLQEEIGEEAGKKKFEFTKDEITPELD
EEIRKYISSDMENALRIPEKLERNAKVDEIKENTLQYFEDMFENNGLDNEEKNKQLKMVE
RTIEKVMKEKVRKMIIEEGIRPDGRKPDEIRPIWCEVGTLPRVHGSGVFTRGQTQALSVV
TLGATSDEQILFGLGEEETKRYMHHYNFPPYSVGETSPLRSPGRREIGHGALGERALQPV
IPDQEEFPYTIRVVSEVLESNGSTSQASICGSTLALMDAGVPIKEPVAGIAMGLLKEDEK
VVILSDIQGLEDFYGDMDFKVAGTRNGITALQMDIKIHGISKEILKKALKRAREGRLYIL
DKMLQVIDKPRPELSPYAPLMITMKVSPDKIRHIIGPGGKIINKIIDETGVEIDIDDDGS
VYILAQDQESGNRAKEIINKLTKEVEVGDIYEGRVKKITNFGAFVEILPGREGLVHISEL
ADHHVKKVEDIVKIGDRIPVKVIEIDELGRINLSRKRALKEQKKE
Download sequence
Identical sequences B8CW78
WP_012635735.1.20074 373903.Hore_07900 gi|220931634|ref|YP_002508542.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]