SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 373903.Hore_11870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  373903.Hore_11870
Domain Number 1 Region: 310-461
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.2e-32
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 202-297
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.06e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 373903.Hore_11870
Sequence length 514
Comment (Halothermothrix orenii H 168)
Sequence
MNNINGGALYVIIALPLGILLGYLIRKYIAEARIQTAEEEARKLLQEAERNAESQKREII
IEAKEIAHNIKEEANRETQKRRNELQRIEDRLVNKEESLDRKTEILEKKEQSLRDKESNL
DKLESEIKELKEKELKTLEEISKFTQEEAKEYLFKKVEEELDHEFAKMIKEKEAKAKEEA
DKKAREILSLAIQRCAADHVAETTVSVVSLPNDEMKGRIIGREGRNIRTLESLTGIDLII
DDTPEAVVISGFDPIRREIARIALEKLIVDGRIHPARIEEMVEKARKELDAHIREVGEEA
TFDAGVHGLHPELVKLLGRLKYRTSYGQNVLQHSLEVSYLAGIMAAELGADINLAKRGGL
LHDIGKSIDHEVEGPHVKIGVDIARKYGESDKVLHIIEAHHGDFEFKSVEAVLVSAADAI
SAARPGARRETLEAYIKRLEELEKLANSFNGVEKAYAIQAGREIRVIVESDKVDDSKAAK
LSRDLAQKIEDNLDYPGQIKVVVIRETRAIDYAK
Download sequence
Identical sequences B8CXB8
373903.Hore_11870 gi|220932024|ref|YP_002508932.1| WP_012636122.1.20074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]