SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 374463.BCI_0627 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374463.BCI_0627
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.1e-47
Family Ribonuclease PH domain 1-like 0.0000263
Further Details:      
 
Domain Number 2 Region: 296-468
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.39e-46
Family Ribonuclease PH domain 1-like 0.0000261
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.09e-26
Family Ribonuclease PH domain 2-like 0.0022
Further Details:      
 
Domain Number 4 Region: 450-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.89e-26
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 612-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.94e-21
Family Cold shock DNA-binding domain-like 0.00011
Further Details:      
 
Domain Number 6 Region: 554-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.01e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 
Domain Number 7 Region: 239-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.49e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 374463.BCI_0627
Sequence length 697
Comment (Baumannia cicadellinicola Homalodisca coagulata)
Sequence
MLNPIVHRFQYGKHIVILETGIVARQATAAVMVNMADTIVLVTVVGVKQVKPGQKFFPLM
VNYQERTYAAGRFPGGFFRREGRPSEGEILISRMIDRPLRPLFPDGFLNEVQVIATVVSI
NPQVSPDIVAMIGVSAALSISGIPFNCPFGAARVGYINNQYVLNPTIAELVDSSLDLVVA
STANAVLMVESEAKQLSEEQMLSAIIFGHEQQQLVIQNINHMVTIVGKPKWSWQAQVIDT
NLQLCVTELAESRLNEAFCISDKQERDVCIETIKSDVLSALQQKNETIEEETISNIFANL
EKQIARNRILGGKLRIDGRNHKMIRSLDMRTSILPRTHGSALFVRGETQALVTVTLGTER
NAQNIDELIGERTDRFLLHYNFPPYCVGEIGLVGSPKRREIGHGRLAKRGILAVMPTANE
FPYTVRVVSEITESNGSSSMASVCGTSLALMDAGVPIKAAVAGVAMGLIKEDNNFVILSD
ILSNEDYIGDMDFKVAGSKNGITALQMDIKTKGITNNIIQLALNQAKDARMHILNMMEQV
ISMSRTDISPFAPRIHTIKIHPDKIKDVIGKCGSVIRALTEETKTIIDIEDDGTVTVAAT
DSIKAQQAICRIKDITAEIEVGSIYHGKVTRIVDFGAFIAISSNKEGLVHISQITNKRVE
KVADYLSIDQIVLVKVLEVDRQGRIRLSMKDTNLTNK
Download sequence
Identical sequences Q1LSL2
gi|94676543|ref|YP_589052.1| 374463.BCI_0627 WP_011520785.1.70559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]