SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 374847.Kcr_1371 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374847.Kcr_1371
Domain Number 1 Region: 62-148
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.83e-17
Family Cold shock DNA-binding domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 144-224
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.64e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00043
Further Details:      
 
Domain Number 3 Region: 6-61
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000001
Family ECR1 N-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 374847.Kcr_1371
Sequence length 228
Comment (Candidatus Korarchaeum cryptofilum OPF8)
Sequence
MSEVTLLVRDKEVVIPGQPLARGKVKPGKDVYVDESGTIRSKKLGLVSLKDDEISIVPLV
GAYIPKEDDLVIGIVSKISGNTILVDIRSPYQGALPIQRRAERVDLKKYDLKIGDVILAK
VRSFDGASSLILTIDAEGLGKLEGGYLLEVDPAKVPRVIGKRQSMLSMLKEATRSEIIVA
NNGRIWVKPPSVKELIVLEKALKKIEEESHVSGLSDRISSLLSQELSR
Download sequence
Identical sequences B1L6N8
374847.Kcr_1371 gi|170290984|ref|YP_001737800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]