SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 374930.CGSHiEE_06135 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374930.CGSHiEE_06135
Domain Number 1 Region: 2-152
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 6.33e-33
Family ATP-dependent DNA ligase catalytic domain 0.0066
Further Details:      
 
Domain Number 2 Region: 127-229
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.31e-31
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 374930.CGSHiEE_06135
Sequence length 231
Comment (Haemophilus influenzae PittEE)
Sequence
MSEKLDGVRGYWNGKQLLTRQGQPLSPPAYFIKDFPPFAIDGELFSERNHFEEISSITKS
FKGDGWEKLKLYVFDVPDAEGNLFERLAKLKAHLLEHPTTYIEIIEQIPVKDKTHLYQFL
AQVENLQGEGVVVRNPNAPYERKRSSQILKLKTARDEECTVIAHHKGKGQFENVMGALTC
KNHRGEFKIGSGFNLNERENPPPIGSVITYKYRGLTSRGKPRFATYWREKK
Download sequence
Identical sequences 374930.CGSHiEE_06135 gi|148826208|ref|YP_001290961.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]