SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 375286.mma_3631 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  375286.mma_3631
Domain Number 1 Region: 63-121
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.000000000785
Family F1F0 ATP synthase subunit B, membrane domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 375286.mma_3631
Sequence length 156
Comment (Janthinobacterium Marseille)
Sequence
MNLNATLIAQFVVFFILAGFTMKFVWPPLMNALDERAKKIADGLAAAERGKSDLAVAEKR
AQAELASAQEAGQKRISDAEKRGQSIIEEAKKTAAEEAARILAAAKADADQQVTQVREAL
RDQVATLAVKGAEQILKREVNATVHADLLNQLKAEL
Download sequence
Identical sequences A6T474
gi|152980004|ref|YP_001355321.1| 375286.mma_3631 WP_012081467.1.39695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]