SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 37692.ATP_00115 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  37692.ATP_00115
Domain Number 1 Region: 72-358
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.3e-77
Family Tandem AAA-ATPase domain 0.0000652
Further Details:      
 
Weak hits

Sequence:  37692.ATP_00115
Domain Number - Region: 394-473
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.1
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 37692.ATP_00115
Sequence length 531
Comment (Candidatus Phytoplasma mali)
Sequence
MDILFENFNILPQTQKALKELNFLKPTAIQNLVISEMIEGYDIIGQAQTGTGKTFAFGIP
IIEKIDLNIKQTQSLILCPTRELALQVFQEFKKLIKFYVEIKIAVIYGGESYIKQFKVLE
TKPHIIIATPGRVIDLLERKKIDFSGLKILTLDEADEMLNMGFQEALETILQKIPKKRQT
VLFSATLPPTIQKIANKYQNNPKVLKVYQKNIAVSSVQQFYFLVKEFDKLKLLVRLLDLE
NPNSVIIFANTKKDVDEINAYLQENNFSVDFLHGDLKQNQRQQVMNNFRNQKIKILIATD
VAARGIDISSITMVINYDLSRQNEIYVHRIGRTGRAGLKGLAYSFVAPSKLSQLKSLENY
LKEKLIFKTIPKVKDIQEKKLKNFQEKIFEMIKNNPQEDINDELIKNLLDNFDNKQIIKA
LLNLIMPIKRNYQEISQTNNFKNNFVNKNFSSSRNMLPLSINLGKKDMINPALLLKILHE
KFNIYSKYVGNIKHLSNESIFEIPNHFWMKIKNKKNIFFNNKILKINQTYL
Download sequence
Identical sequences B3R0D8
WP_012504270.1.43358 37692.ATP_00115 gi|194246516|ref|YP_002004155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]