SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 377628.YPN_0597 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  377628.YPN_0597
Domain Number 1 Region: 27-170
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-48
Family Ribonuclease PH domain 1-like 0.0000163
Further Details:      
 
Domain Number 2 Region: 319-514
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.96e-47
Family Ribonuclease PH domain 1-like 0.0000161
Further Details:      
 
Domain Number 3 Region: 171-261
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-30
Family Ribonuclease PH domain 2-like 0.0012
Further Details:      
 
Domain Number 4 Region: 476-574
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.87e-28
Family Ribonuclease PH domain 2-like 0.0000798
Further Details:      
 
Domain Number 5 Region: 580-665
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.33e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Domain Number 6 Region: 646-721
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.12e-21
Family Cold shock DNA-binding domain-like 0.0000297
Further Details:      
 
Domain Number 7 Region: 264-346
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 4.45e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 377628.YPN_0597
Sequence length 731
Comment (Yersinia pestis Nepal516)
Sequence
MQCEGISNRWIRSSIRSGTAKHKGTILLTPIIRKFQYGQHTVTIETGMMARQATAAVMVS
MDDTAVFVTVVGQKKAKPGQSFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLTSRL
IDRPIRPLFPDSFLNEVQVIATVVSVNPQINPDIVALIGASAVLSLSGIPFNGPIGAARV
GFINDQYVLNPTTDELKESRLDLVVAGTAGAVLMVESEADILSEEQMLGAVVFGHEQQQV
VIENINALVAEAGKPKWDWQAEPVNEALHARVAELAEARLGDAYRITEKQERYTQVDAIK
ADVTEALLAQDDTLDAAEIQDILASVEKNVVRSRVLRGEPRIDGREKDMIRGLDVRTGIL
PRTHGSALFTRGETQALVTATLGTARDAQNIDELMGERTDSFLLHYNFPPYCVGETGMVG
SPKRREIGHGRLAKRGVLAVMPSASEFPYTIRVVSEITESNGSSSMASVCGASLALMDAG
VPIKAAVAGIAMGLVKEGDNFVVLSDILGDEDHLGDMDFKVAGSRDGVTALQMDIKIEGI
TREIMQVALNQAKGARLHILGVMEQAISTPRGDISEFAPRIYTMKINPEKIKDVIGKGGS
VIRALTDETGTTIEIEDDGTIKIAATDGDKAKHAIRRIEEITAEIEVGRIYAGKVTRIVD
FGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVDRQGRIRLSIKEATT
PDAEAPEAAAE
Download sequence
Identical sequences gi|108810762|ref|YP_646529.1| 377628.YPN_0597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]