SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 377629.TERTU_4592 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  377629.TERTU_4592
Domain Number 1 Region: 7-119
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000011
Family Sfri0576-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 377629.TERTU_4592
Sequence length 124
Comment (Teredinibacter turnerae T7901)
Sequence
MVTVGRNGENRLDVALSGKLDTEGMIAVLDALLDNAEGMENGGVLFDVVDYHLPSFGAIA
IELWRLPQVLRLLRRFSHAAVLADQTWLQAMSHWSADLVPGLTIKTFKRSEKAAARLWLE
TVCP
Download sequence
Identical sequences C5BJV0
377629.TERTU_4592 gi|254788392|ref|YP_003075821.1| WP_015817796.1.38994 WP_015817796.1.78565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]