SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 379066.GAU_1764 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  379066.GAU_1764
Domain Number 1 Region: 291-485
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.95e-47
Family Ribonuclease PH domain 1-like 0.0000334
Further Details:      
 
Domain Number 2 Region: 4-140
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-44
Family Ribonuclease PH domain 1-like 0.0000254
Further Details:      
 
Domain Number 3 Region: 450-557
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.57e-28
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 141-230
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.71e-24
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 5 Region: 606-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-21
Family Cold shock DNA-binding domain-like 0.0012
Further Details:      
 
Domain Number 6 Region: 236-315
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000575
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0048
Further Details:      
 
Domain Number 7 Region: 551-616
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000835
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 379066.GAU_1764
Sequence length 732
Comment (Gemmatimonas aurantiaca T 27)
Sequence
MHRIERTFAGRPLVIETGRMAKQAAGSAVVQFGETMVLAAVTVSENQSPLPFFPLTVEYK
EKTYAAGKIPGGFIKREGRPHDHEILAARIIDRSIRPLFPEGFKNEVQVFIYVISADQEN
DADVLALVAASFALNASKIPFLGPIAGVRVGRVQGHWVLNPTFQQLGFSDLELVVAGSKD
SIVMVEGGSLEVSEEDVLESLRLSHDGIRELIGMQEELLAKVRVPKMSWVKAEAPEGITT
RVKELASGRIREALNQKDKHTRIEAVERTKKELAEGLLVEFPDNAKDIGNLLGDVEYHEL
RSQVLDTQLRVDGRKKDEVRAISIDTSVLPRAHGSALFTRGQTQALVAATLGTAKDAQRL
DSIKEPGEVTRSFMLHYNFPPFSTGEVRPMRGTSRREIGHGNLAERALQGVLPDFADFPY
TIRIVSDVLESNGSSSMASVCGGSLSLFDAGVPLKAAVAGVAMGLIKEGERYAILTDILG
TEDHLGDMDFKVAGTKDGITSIQMDIKIEGLDIKIMEEALSQAKAGRLHILGEMDKALAA
PREDLSKYAPRIVTVQIPVDKIGELIGPKGKNIRGIQDETGAELSVEDDGTVTIAAVGGD
SMERAKQMVMAITAEPVVGETYEGTVKTVTAFGAFVEIMPGNEALLHVSEMRWERVEKPE
DVVKKGDRVTVKLVDRDERGRLRLSMKALLPKPEGMPDEPPQSERPRRDDGERSGGDRGG
RGGRNGGGRDRR
Download sequence
Identical sequences C1A3Y1
gi|226227170|ref|YP_002761276.1| WP_012683253.1.17207 379066.GAU_1764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]