SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 379066.GAU_1871 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  379066.GAU_1871
Domain Number 1 Region: 320-478
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.49e-27
Family HD domain 0.022
Further Details:      
 
Domain Number 2 Region: 216-312
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.21e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 379066.GAU_1871
Sequence length 528
Comment (Gemmatimonas aurantiaca T 27)
Sequence
MGELSLAALTGALGMVAAVIAFVFGRRSGRQAEIGEQQRAKATAEDTAGRILDEARREAD
TLRKGAIVSGKEEVLQLRETHEQEFRQRRVDVEREEKRILERESQVDRVREGLEGRELEV
QRRGKELTQREDAATARSLELDTLFADERRRLEQIAGLSADQAKAELVRRLEDEALADAA
SRLREIRESAKRNADREARKIVALAVQRVAAETTAETTVSAVALPNDEMKGRIIGREGRN
IRAFELATGVDVIIDDTPDTVVVSCFDPVRRETARLALEKLVSDGRIHPGRIEEVVAKAR
REVEVAIVETGEQAAYEVGITGLHPELIKLIGRMKWRTSYGQNILAHSKEVAWLAGMMAA
ELGLDVALAKRGALLHDIGKVLTHEHEGTHVQLGVEMATKYGENPLVVNCIAAHHDDVPH
ESEVSVLVQAADGISGSRPGARREAFETYVKRLEGLERIASSYRGVERVFAIQAGREVRV
VVTPEQVDDLRMAALSEEIARRIESELQYPGQIKVVVIRESRAVDFAR
Download sequence
Identical sequences C1A488
gi|226227277|ref|YP_002761383.1| 379066.GAU_1871 WP_012683360.1.17207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]