SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 380703.AHA_0291 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  380703.AHA_0291
Domain Number 1 Region: 12-196
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.03e-38
Family Pentapeptide repeats 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 380703.AHA_0291
Sequence length 216
Comment (Aeromonas hydrophila ATCC 7966)
Sequence
MIKDKCFEGVRFEQQDLEGEQFQGCRFIGCNFSWLDLAECRFVDCSFYDRESEQSCLLQG
CDLREASFLRCDLTMADCSRSQCLGLELRDCQALGINFSRASFANQITVKSYFCEAHLTG
NNFSYANFEGCLLEQCELSGNRWQGANLFGASLAGSDLSGSEFGQIDWASVNLQGCDLRQ
CDLPGLDLRRVNLDGVQINEDQQQALLEQIGLIVFP
Download sequence
Identical sequences A0KF03
WP_011704297.1.12787 YP_854820.1.44769 000179656|e3pssA1|207.9.1.1|A:1-216 000411139|e3pssB1|207.9.1.1|B:1-216 000411140|e3pszA1|207.9.1.1|A:1-216 000411141|e3pszB1|207.9.1.1|B:1-216 3pss_A 3pss_B 3psz_A 3psz_B 380703.AHA_0291 gi|117620527|ref|YP_854820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]