SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 380703.AHA_0536 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  380703.AHA_0536
Domain Number - Region: 12-123
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00471
Family Sfri0576-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 380703.AHA_0536
Sequence length 131
Comment (Aeromonas hydrophila ATCC 7966)
Sequence
MKLQPHGHFEMQRRGQVLICRPSGPFNLAGAMAYEAQFSQQIASLRDAPWGIVEVATEFE
AAGPEVLTRFRRQFGWCASNGCAFLAVVLAGSFKQYLADQVFSGLPFQGVRYFEQTDEAL
QWLERQLAGLV
Download sequence
Identical sequences A0KFP3
gi|117620644|ref|YP_855069.1| WP_011704509.1.12787 YP_855069.1.44769 380703.AHA_0536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]