SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 380703.AHA_1109 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  380703.AHA_1109
Domain Number - Region: 44-108
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0889
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 380703.AHA_1109
Sequence length 185
Comment (Aeromonas hydrophila ATCC 7966)
Sequence
MQKGFMKYIHACRYLLLLPLLLLAGCGSSLEEYRGQGPEWDLARFFNGKLTAHGLVTDRS
GEVTSRFRVEMRGHWQGDKGELFEQFYFDDGRQQTRTWFLSKGADGHWRGTAADVVGEAV
GKTAGFALNWRYQLDLALLDGSVVRVSFDDWMYLLDENRLLNRAAISKFGIQLGEVLLYI
ERQPE
Download sequence
Identical sequences A0KHA0
gi|117620145|ref|YP_855651.1| 380703.AHA_1109 WP_011705036.1.12787 YP_855651.1.44769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]