SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 380749.HY04AAS1_0875 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  380749.HY04AAS1_0875
Domain Number 1 Region: 379-512
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.11e-26
Family HD domain 0.032
Further Details:      
 
Domain Number 2 Region: 266-358
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.65e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 380749.HY04AAS1_0875
Sequence length 575
Comment (Hydrogenobaculum Y04AAS1)
Sequence
METVVIGILSILVLVLSGFGFLAFKKLSEKQVVNLPNTSEESKILLEEAKRQADAILEEA
KKQLEYSKELAEREASKYMEFIKKENEKLGKEKEAIKKELELRKEELEKDYIRKQEELSS
KEQSLLQRERSLESKEINLERKLQSLEKKEEELYAKERELRELEKALQKREKEIEQQYKN
VETIKSEIEELKNKELLELQRIASLTKEEAYQEILRKAEEEAKIESIRIAKAIEEKAKEE
AEREAKRIITTSIQRLSPEIAINYSTSTIELPSNEFKGRIIGREGRNIRAFEILTGVDII
IDDTPDTVTLSSFDPMRREIAKQALGKLIIDGRIHPARIEEVVEEVKKEMDNNIRKLGEE
TVMELGIHDMNPGLYYYIGKLYYRTSYSQNVLLHSKEVATIAGLMAAELGLNEKAAKRAG
LLHDIGKAISNEMGGSHTDIGIELCKKYKEPDYVLNAIKAHHEEEPVKYPEVALVCAADA
LSAARPGARRESLEAYIKRLEKLEEIVKSFPGVSNVYAMQAGREVRVIVSPSELTDEQAY
DMSKKIAKKIEEEMDYPGNIKVVVIRENRFVEYAR
Download sequence
Identical sequences B4U8V1
380749.HY04AAS1_0875 WP_012513918.1.45798 gi|195953250|ref|YP_002121540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]