SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 381764.Fnod_0759 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  381764.Fnod_0759
Domain Number 1 Region: 143-221
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.0000628
Family V-type ATPase subunit E 0.0061
Further Details:      
 
Weak hits

Sequence:  381764.Fnod_0759
Domain Number - Region: 62-100
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.000968
Family F1F0 ATP synthase subunit B, membrane domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 381764.Fnod_0759
Sequence length 233
Comment (Fervidobacterium nodosum Rt17-B1)
Sequence
MLIRKRYVYLDAPMKIESNKGQIEKEKQEENIRNEQELLEMVARANKEAEQIVFSAQNQV
QQMIQQAQEEYNKIIEEANKRSKEIIDNTVNEVEETKRELNERIKSILFSFETSFDNLLS
MYSEKIATITKILVEKFLEKEIDSEVTKRKIEKVLSHVVGATKVKIHINPEDAKLIDQEI
LDEIRSKNYEVVLNDSVSQGVIVETDLGTIDTTLKFQFALLDEIFDEVFKQEL
Download sequence
Identical sequences A0A2C6KBU9 A7HL29
381764.Fnod_0759 WP_011993929.1.63945 gi|154249444|ref|YP_001410269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]