SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 381764.Fnod_1293 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  381764.Fnod_1293
Domain Number 1 Region: 312-467
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.83e-32
Family HD domain 0.016
Further Details:      
 
Domain Number 2 Region: 209-300
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.76e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Weak hits

Sequence:  381764.Fnod_1293
Domain Number - Region: 6-120
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0549
Family L-aspartase/fumarase 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 381764.Fnod_1293
Sequence length 517
Comment (Fervidobacterium nodosum Rt17-B1)
Sequence
MEWLIYIVILFVGIAAGAFFGISVGRKRAEEALEKKLKAAKEDAESIIKSAEKEASEIKK
KAIIEAREEAHQIREEIEKERKKREEEIKQLEERLLKREEMLSKREELIDKRENYVENLK
IELESKAKEIEEKAKEIERRFIELAGITHEQAREIVLQEAREKYEHEIAKFFVQIKTRYE
DEADKYAKKIIADAIQRYAPEYIGEVTISTVALPNDDMKGRLIGREGRNIRTFEKITGVD
LIIDDTPEMVTLSSFNPLRREVARRTIEKLVQDGRIHPARIEEMYEKAKAEVEREIKEAG
QDAVITVGVGGLHPEIIKLLGRLKFRTSYGQNVLAHSVEVAQIAGLLAAELGLNVDKAKR
GGLLHDIGKAIDHEVEGSHTDIGAEMLKRYGESDEIINMVMAHHGQEEPITPEAAIVAAA
DAISAARPGARREDVENYIKRLMKLEEIAKSYKYVENAYAIQAGREIRVIVQPDKTDDAT
IEKLAHDIATRIENELQYPGVLKVVVIREKRSVSYAK
Download sequence
Identical sequences A0A2C6KAL9 A7HMK7
381764.Fnod_1293 gi|154249972|ref|YP_001410797.1| WP_011994449.1.63945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]