SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 382638.Hac_0656 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  382638.Hac_0656
Domain Number 1 Region: 305-449
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.26e-25
Family HD domain 0.022
Further Details:      
 
Domain Number 2 Region: 186-269
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000346
Family Eukaryotic type KH-domain (KH-domain type I) 0.0061
Further Details:      
 
Weak hits

Sequence:  382638.Hac_0656
Domain Number - Region: 85-144
Classification Level Classification E-value
Superfamily STAT 0.0235
Family STAT 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 382638.Hac_0656
Sequence length 503
Comment (Helicobacter acinonychis Sheeba)
Sequence
MKKIYYARGQAVLKSASAKAKLMEFQAKSFVEAEEMRMKSQECKLQQQYENKNLQLKAHF
DKKEAYLKHLEAQHKEFVRDEKRYLEKEKQELEKERQILEQEKENFKKQYATCKENQSKA
LDVMLNYMAYTKEEIKSMILKQLEEELEAQKSALIRRYEKEAKEESKKKSYAILAEATAR
FAGNYAIENFTNRIALPCSEYIGRVIGKDGKNIEAFKKISGVDIEFSEGDKELCLSSFNI
FRREVASETLKILIEDGRIQPNRIEEVYHRVVRNMEKELLSEGQSVVLELELGAMEDELK
ILLGKMRYRSSFGQNALQHSKEVALLAGLIAEQLGGDKKLARRAGILHDIGKALTQELGR
DHVSLGVEVCKRNKEDPVVINAIYAHHGHEEIMSIECASVCAADALSAGRPGARRKSDEE
YAKRMQALEEIALGFEGVEKAYAMESGRELRVIVKSNQVRDNQVPIIARKIAKKIEESAQ
YVGEVGVQVVRESRFKTTATLKQ
Download sequence
Identical sequences 382638.Hac_0656 gi|109947233|ref|YP_664461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]