SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 384676.PSEEN4101 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  384676.PSEEN4101
Domain Number - Region: 4-56
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0105
Family Myosin rod fragments 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 384676.PSEEN4101
Sequence length 68
Comment (Pseudomonas entomophila L48)
Sequence
MSLEMRIVELETRQAFQDDTIQALNDEVVEQSRVIERLQLQVAELIKRYEEMVGQYAGGG
EEPPPPHY
Download sequence
Identical sequences Q1I6E0
gi|104783081|ref|YP_609579.1| WP_011535166.1.45913 384676.PSEEN4101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]