SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 387092.NIS_0611 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  387092.NIS_0611
Domain Number 1 Region: 119-175
Classification Level Classification E-value
Superfamily AFP III-like domain 0.000000119
Family AFP III-like domain 0.006
Further Details:      
 
Weak hits

Sequence:  387092.NIS_0611
Domain Number - Region: 24-82
Classification Level Classification E-value
Superfamily BT0923-like 0.000118
Family BT0923-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 387092.NIS_0611
Sequence length 238
Comment (Nitratiruptor SB155-2)
Sequence
MVVTKEEVRRLLQENFIDTSHITIKGEKTTLSLEKKTLSKELLEQAIRKYFKKRYPNKEI
KKISLHMKPIEIMGKYTIAVEPETVSRNYAYVKVHIKQANKAAHVYRAYVIIKTLANVVV
AVHDIPRGSLIQKKDLAVQKMVTHGKNYPDLQEIIGSVARVNIYKNRKITRYMIEPNYAV
KKRQNVRIIYAKGPIRIELLGLALQNGKRGDIIKVKNISTNKVLECKVLSDGVVQFLY
Download sequence
Identical sequences A6Q2L6
387092.NIS_0611 gi|152990360|ref|YP_001356082.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]