SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 387092.NIS_1053 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  387092.NIS_1053
Domain Number 1 Region: 327-472
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.84e-28
Family HD domain 0.038
Further Details:      
 
Domain Number 2 Region: 213-305
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000102
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 387092.NIS_1053
Sequence length 522
Comment (Nitratiruptor SB155-2)
Sequence
MWVEILVGSSAAIISGAAGYLLSKKIEKDKLKIYEEQARAKAKAIEHEAEKILQNAQVQV
KEAELELKRDFEKKLEELKRDYEERFNELMEKEMSLKQMFKDELKHITLEKQEIKAEREE
INRLKNEYEELKKRYQEKYQEVLEALQQQAGLTLEEAKNLILQKAEEESRLEIANIVRKY
EEEAKREAKRRANYIIAQATTRFAGEFAAERLINTVSIPSEDIKGRIIGKEGRNIKTLEM
LLGVDIIIDDTPNAIILSSFNLYRRAIATKVIELLVEDGRIQPSRIEEIYEKVKEEFDQQ
LLEEGENIVIDLGIGLIHPEIVKLIGRLKFRASYGQNALGHSLEVAHLAGIMAAEMGGDE
VMAKRAGLLHDIGKALTHEYSGSHVDLGAEICKRYKEPDVVINAIYAHHGHEEPRSIEAA
AVCAADTLSAARPGARREVLEAFLKRVQAIEEIALSKPGVKKAYAINAGREVRVIVNADL
VNDNEAVLLAKEIAKDIETGVQYPGEIKVNVIRENRAIEYAR
Download sequence
Identical sequences A6Q3V4
387092.NIS_1053 gi|152990798|ref|YP_001356520.1| WP_012082426.1.54627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]