SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 387092.NIS_1504 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  387092.NIS_1504
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Ribosomal protein S16 2.22e-30
Family Ribosomal protein S16 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 387092.NIS_1504
Sequence length 75
Comment (Nitratiruptor SB155-2)
Sequence
MVVIRLARFGRKKRPFYRIVVTDSRKRRDSGWIESIGYYNPLTDPVTVKIDEERLNYWLG
VGAKMSERVKKLSGK
Download sequence
Identical sequences A6Q552
387092.NIS_1504 WP_012082874.1.54627 gi|152991246|ref|YP_001356968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]