SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 387093.SUN_1873 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  387093.SUN_1873
Domain Number 1 Region: 32-127
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 8.24e-23
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0017
Further Details:      
 
Domain Number 2 Region: 137-183
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 5.1e-16
Family Head domain of nucleotide exchange factor GrpE 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 387093.SUN_1873
Sequence length 184
Comment (Sulfurovum NBC37-1)
Sequence
MSQETEKDLEQTQNEELVEEAQSDEKKDQEVDPVEAAQAEAAEYKDKYIRAHADFENAKK
RLEKDKMNAVAYANESFAKDILAVLDSFENALSAIEGANKENAAEVLEKMQEGVKLTYEQ
LKKVLEKNSIKEIESKGTFNPEVHQAIMQVDSDEHKTDDIVQVMQKGYTIKDRVLRPAMV
STAK
Download sequence
Identical sequences A6QBG1
WP_012083633.1.96465 gi|152993456|ref|YP_001359177.1| 387093.SUN_1873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]